PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr016562.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family CO-like
Protein Properties Length: 398aa    MW: 43929.6 Da    PI: 5.4155
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr016562.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box19.91.5e-061859439
     zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39
                 r+C+++     + +C+ ++ +lC  C  ++H        H++
  Pbr016562.1 18 RVCDTCRAAACTVYCRADSAYLCSGCDATIHAAnrlasrHER 59
                 79******99*********************55667777775 PP

2zf-B_box29.51.6e-0960105342
     zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                   ++C+ +e+ ++ + C+ +   lC  C   +H+       H++vp+
  Pbr016562.1  60 VWVCEACERAPAAFLCKADAASLCTACDADIHSAnplarrHQRVPI 105
                  689*****************************66899999**9997 PP

3CCT69.77.3e-24328371144
          CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                  Rea++lRY+eK+ktRkFeK+irY+sRKa+Ae+RpR+KGrF+k++
  Pbr016562.1 328 REARVLRYREKKKTRKFEKTIRYASRKAYAETRPRIKGRFAKRT 371
                  9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003365.8E-81562IPR000315B-box-type zinc finger
PROSITE profilePS5011910.581562IPR000315B-box-type zinc finger
CDDcd000212.35E-71862No hitNo description
PROSITE profilePS5011911.30558105IPR000315B-box-type zinc finger
PfamPF006431.4E-759105IPR000315B-box-type zinc finger
CDDcd000214.15E-961105No hitNo description
SMARTSM003361.8E-1063105IPR000315B-box-type zinc finger
PfamPF062037.9E-18328370IPR010402CCT domain
PROSITE profilePS5101716.648328370IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009658Biological Processchloroplast organization
GO:0009909Biological Processregulation of flower development
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048576Biological Processpositive regulation of short-day photoperiodism, flowering
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 398 aa     Download sequence    Send to blast
MLKEDQSNGT ATANNWARVC DTCRAAACTV YCRADSAYLC SGCDATIHAA NRLASRHERV  60
WVCEACERAP AAFLCKADAA SLCTACDADI HSANPLARRH QRVPILPISG CLYSSQATEQ  120
GGMGVVVSAG AETEDGFLSQ EGDDTIDEED EDEAASWLLL NPVKNSSNNN NNTNAQNNGF  180
FFGVEVDEYL DLVEYNSCAD QNNQFTDHHQ QHDQQEQQQY GVQYKNYGGD SVVPVHQHGE  240
GGKAHQMQQL QKQSFHQLGL EYESSKAAYS YNGSLSHSVS VSSMDVGVVP DSTMSDISIS  300
HPRTPKGTID LFSGPTIQMP TQLSPMDREA RVLRYREKKK TRKFEKTIRY ASRKAYAETR  360
PRIKGRFAKR TEMEVEVDQM FATSLMAENG YGIVPSF*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009373735.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 2
SwissprotQ965021e-148COL2_ARATH; Zinc finger protein CONSTANS-LIKE 2
TrEMBLD9ZIX40.0D9ZIX4_MALDO; COL domain class transcription factor
STRINGPOPTR_0017s14410.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38273352
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02380.11e-111CONSTANS-like 2